Lineage for d5mj6b4 (5mj6 B:707-1025)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2726072Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2726073Protein automated matches [190220] (14 species)
    not a true protein
  7. 2726099Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries)
  8. 2726131Domain d5mj6b4: 5mj6 B:707-1025 [332733]
    Other proteins in same PDB: d5mj6a1, d5mj6a2, d5mj6a3, d5mj6a5, d5mj6b1, d5mj6b2, d5mj6b3, d5mj6b5
    automated match to d4pj6a4
    complexed with 7o2, br, nag, zn

Details for d5mj6b4

PDB Entry: 5mj6 (more details), 2.53 Å

PDB Description: ligand-induced conformational change of insulin-regulated aminopeptidase: insights on catalytic mechanism and active site plasticity.
PDB Compounds: (B:) Leucyl-cystinyl aminopeptidase

SCOPe Domain Sequences for d5mj6b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mj6b4 a.118.1.0 (B:707-1025) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddwealihqlkinpyvlsdkdranlinnifelaglgkvplkrafdlinylgnenhtapit
ealfqtdliynlleklgymdlasrlvtrvfkllqnqiqqqtwtdegtpsmrelrsallef
acthnlgncsttamklfddwmasngtqslptdvmttvfkvgaktdkgwsfllgkyisigs
eaeknkilealassedvrklywlmksslngdnfrtqklsfiirtvgrhfpghllawdfvk
enwnklvqkfplgsytiqnivagstylfstkthlsevqaffenqseatfrlrcvqealev
iqlniqwmeknlksltwwl

SCOPe Domain Coordinates for d5mj6b4:

Click to download the PDB-style file with coordinates for d5mj6b4.
(The format of our PDB-style files is described here.)

Timeline for d5mj6b4: