Lineage for d5iw1b2 (5iw1 B:112-235)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2761190Domain d5iw1b2: 5iw1 B:112-235 [332464]
    Other proteins in same PDB: d5iw1c1
    automated match to d3mffb2

Details for d5iw1b2

PDB Entry: 5iw1 (more details), 3 Å

PDB Description: crystal structure of b4.2.3 t-cell receptor
PDB Compounds: (B:) T-cell receptor beta chain

SCOPe Domain Sequences for d5iw1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iw1b2 b.1.1.0 (B:112-235) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvctdpq
aykesnysyalssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgra

SCOPe Domain Coordinates for d5iw1b2:

Click to download the PDB-style file with coordinates for d5iw1b2.
(The format of our PDB-style files is described here.)

Timeline for d5iw1b2: