| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (28 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries) |
| Domain d5iw1b2: 5iw1 B:112-235 [332464] Other proteins in same PDB: d5iw1c1 automated match to d3mffb2 |
PDB Entry: 5iw1 (more details), 3 Å
SCOPe Domain Sequences for d5iw1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5iw1b2 b.1.1.0 (B:112-235) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvctdpq
aykesnysyalssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgra
Timeline for d5iw1b2: