PDB entry 5iw1

View 5iw1 on RCSB PDB site
Description: Crystal Structure of B4.2.3 T-Cell Receptor
Class: immune system
Keywords: T-cell Receptor, TCR, B4.2.3, B423, MHC Class I, MOLECULAR RECOGNITION, HUMAN IMMUNODEFICIENCY VIRUS, IMMUNE SYSTEM
Deposited on 2016-03-21, released 2017-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-cell receptor alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: TCRAV2S6J38
    Database cross-references and differences (RAF-indexed):
    • PDB 5IW1 (0-End)
    Domains in SCOPe 2.07: d5iw1a1, d5iw1a2
  • Chain 'B':
    Compound: T-cell receptor beta chain
    Species: Mus musculus [TaxId:10090]
    Gene: TCRAV2S6J38
    Database cross-references and differences (RAF-indexed):
    • PDB 5IW1 (Start-234)
    Domains in SCOPe 2.07: d5iw1b1, d5iw1b2
  • Chain 'C':
    Compound: T-cell receptor alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: TCRAV2S6J38
    Database cross-references and differences (RAF-indexed):
    • PDB 5IW1 (0-End)
    Domains in SCOPe 2.07: d5iw1c1, d5iw1c2
  • Chain 'D':
    Compound: T-cell receptor beta chain
    Species: Mus musculus [TaxId:10090]
    Gene: TCRAV2S6J38
    Database cross-references and differences (RAF-indexed):
    • PDB 5IW1 (Start-234)
    Domains in SCOPe 2.07: d5iw1d1, d5iw1d2
  • Chain 'E':
    Compound: T-cell receptor alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: TCRAV2S6J38
    Database cross-references and differences (RAF-indexed):
    • PDB 5IW1 (0-End)
    Domains in SCOPe 2.07: d5iw1e1, d5iw1e2
  • Chain 'F':
    Compound: T-cell receptor beta chain
    Species: Mus musculus [TaxId:10090]
    Gene: TCRAV2S6J38
    Database cross-references and differences (RAF-indexed):
    • PDB 5IW1 (Start-234)
    Domains in SCOPe 2.07: d5iw1f1, d5iw1f2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5iw1A (A:)
    qqvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvsnkkedgr
    ftiffnkrekklslhiadsqpgdsatyfcaasasfgdnskliwglgtslvvnpniqnpep
    avyqlkdprsqdstlclftdfdsqinvpktmesgtfitdkcvldmkamdsksngaiawsn
    qtsftcqdifketn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iw1A (A:)
    qqvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvsnkkedgr
    ftiffnkrekklslhiadsqpgdsatyfcaasasfgdnskliwglgtslvvnpniqnpep
    avyqlkdprsqdstlclftdfdsqinvpktmesgtfitdkcvldmkamdsksngaiawsn
    qtsftcqdi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5iw1B (B:)
    mkvtqmprylikrmgenvllecgqdmshetmywyrqdpglglqliyisydvdsnsegdip
    kgyrvsrkkrehfslildsaktnqtsvyfcasslghtevffgkgtrltvvedlrnvtppk
    vslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvctdpqaykesnysy
    alssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgra
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iw1B (B:)
    vtqmprylikrmgenvllecgqdmshetmywyrqdpglglqliyisydvdsnsegdipkg
    yrvsrkkrehfslildsaktnqtsvyfcasslghtevffgkgtrltvvedlrnvtppkvs
    lfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvctdpqaykesnysyal
    ssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5iw1C (C:)
    qqvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvsnkkedgr
    ftiffnkrekklslhiadsqpgdsatyfcaasasfgdnskliwglgtslvvnpniqnpep
    avyqlkdprsqdstlclftdfdsqinvpktmesgtfitdkcvldmkamdsksngaiawsn
    qtsftcqdifketn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iw1C (C:)
    qqvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvsnkkedgr
    ftiffnkrekklslhiadsqpgdsatyfcaasasfgdnskliwglgtslvvnpniqnpep
    avyqlkdprsqdstlclftdfdsqinvpktmesgtfitdkcvldmkamdsksngaiawsn
    qtsftcqdi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5iw1D (D:)
    mkvtqmprylikrmgenvllecgqdmshetmywyrqdpglglqliyisydvdsnsegdip
    kgyrvsrkkrehfslildsaktnqtsvyfcasslghtevffgkgtrltvvedlrnvtppk
    vslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvctdpqaykesnysy
    alssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgra
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iw1D (D:)
    vtqmprylikrmgenvllecgqdmshetmywyrqdpglglqliyisydvdsnsegdipkg
    yrvsrkkrehfslildsaktnqtsvyfcasslghtevffgkgtrltvvedlrnvtppkvs
    lfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvctdpqaykesnysyal
    ssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgra
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5iw1E (E:)
    qqvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvsnkkedgr
    ftiffnkrekklslhiadsqpgdsatyfcaasasfgdnskliwglgtslvvnpniqnpep
    avyqlkdprsqdstlclftdfdsqinvpktmesgtfitdkcvldmkamdsksngaiawsn
    qtsftcqdifketn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iw1E (E:)
    qqvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvsnkkedgr
    ftiffnkrekklslhiadsqpgdsatyfcaasasfgdnskliwglgtslvvnpniqnpep
    avyqlkdprsqdstlclftdfdsqinvpktmesgtfitdkcvldmkamdsksngaiawsn
    qtsftcqdi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5iw1F (F:)
    mkvtqmprylikrmgenvllecgqdmshetmywyrqdpglglqliyisydvdsnsegdip
    kgyrvsrkkrehfslildsaktnqtsvyfcasslghtevffgkgtrltvvedlrnvtppk
    vslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvctdpqaykesnysy
    alssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgra
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iw1F (F:)
    vtqmprylikrmgenvllecgqdmshetmywyrqdpglglqliyisydvdsnsegdipkg
    yrvsrkkrehfslildsaktnqtsvyfcasslghtevffgkgtrltvvedlrnvtppkvs
    lfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvctdpqaykesnysyal
    ssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgra