SCOPe 2.08: Domain d5iw1c1: 5iw1 C:3-116

Lineage for d5iw1c1 (5iw1 C:3-116)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (22 PDB entries)

8. Domain d5iw1c1: 5iw1 C:3-116 [332343]
   Other proteins in same PDB: d5iw1a1, d5iw1a2, d5iw1b1, d5iw1b2, d5iw1c2, d5iw1d1, d5iw1d2, d5iw1e1, d5iw1e2, d5iw1f1, d5iw1f2
   automated match to d1tcra1

Details for d5iw1c1

PDB Entry: 5iw1, 3 Å

PDB Description: crystal structure of b4.2.3 t-cell receptor

PDB Compounds: (C:) T-cell receptor alpha chain

SCOPe Domain Sequences for d5iw1c1:

Sequence; same for both SEQRES and ATOM records:

>d5iw1c1 b.1.1.1 (C:3-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
qqvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvsnkkedgr
ftiffnkrekklslhiadsqpgdsatyfcaasasfgdnskliwglgtslvvnpn

Timeline for d5iw1c1:

• d5iw1c1 first appeared in SCOPe 2.06
  
• d5iw1c1 appears in SCOPe 2.07