SCOPe 2.08: Domain d5iw1a2: 5iw1 A:117-191

Lineage for d5iw1a2 (5iw1 A:117-191)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5iw1a2: 5iw1 A:117-191 [332441]
   Other proteins in same PDB: d5iw1c1
   automated match to d1tcra2

Details for d5iw1a2

PDB Entry: 5iw1, 3 Å

PDB Description: crystal structure of b4.2.3 t-cell receptor

PDB Compounds: (A:) T-cell receptor alpha chain

SCOPe Domain Sequences for d5iw1a2:

Sequence; same for both SEQRES and ATOM records:

>d5iw1a2 b.1.1.0 (A:117-191) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpepavyqlkdprsqdstlclftdfdsqinvpktmesgtfitdkcvldmkamdsksng
aiawsnqtsftcqdi

Timeline for d5iw1a2:

• d5iw1a2 first appeared in SCOPe 2.06
  
• d5iw1a2 appears in SCOPe 2.07