|  | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) | 
|  | Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies) | 
|  | Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family)  | 
|  | Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (3 proteins) | 
|  | Protein Glycyl-tRNA synthetase (GlyRS), C-terminal domain [52960] (1 species) | 
|  | Species Thermus thermophilus [TaxId:274] [52961] (3 PDB entries) | 
|  | Domain d1atib1: 1ati B:395-505 [33197] Other proteins in same PDB: d1atia2, d1atib2 | 
PDB Entry: 1ati (more details), 2.75 Å
SCOP Domain Sequences for d1atib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1atib1 c.51.1.1 (B:395-505) Glycyl-tRNA synthetase (GlyRS), C-terminal domain {Thermus thermophilus}
qlapikvaviplvknrpeiteyakrlkarllalglgrvlyedtgnigkayrrhdevgtpf
avtvdydtigqskdgttrlkdtvtvrdrdtmeqirlhvdelegflrerlrw
Timeline for d1atib1: