PDB entry 1ati

View 1ati on RCSB PDB site
Description: crystal structure of glycyl-trna synthetase from thermus thermophilus
Deposited on 1996-04-23, released 1997-07-07
The last revision prior to the SCOP 1.55 freeze date was dated 1997-07-07, with a file datestamp of 1997-07-08.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.227
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1atiA (A:)
    aassldelvalckrrgfifqsseiygglqgvydygplgvelknnlkqawwrrnvyerddm
    egldasvlthrlvlhysgheatfadpmvdnritkkryrldhllkeqpeevlkrlyramev
    eeenlhalvqammqaperaggamtaagvldpasgepgdwtppryfnmmfqdlrgprggrg
    llaylrpetaqgifvnfknvldatsrklgfgiaqigkafrneitprnfifrvrefeqmei
    eyfvrpgedeywhrywveerlkwwqemglsrenlvpyqqppessahyakatvdilyrfph
    gslelegiaqrtdfdlgshtkdqealgitarvlrnehstqrlayrdpetgkwfvpyviep
    sagvdrgvlallaeaftreelpngeerivlklkpqlapikvaviplvknrpeiteyakrl
    karllalglgrvlyedtgnigkayrrhdevgtpfavtvdydtigqskdgttrlkdtvtvr
    drdtmeqirlhvdelegflrerlrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1atiA (A:)
    aassldelvalckrrgfifqsseiygglqgvydygplgvelknnlkqawwrrnvyerddm
    egldasvlthrlvlhysgheatfadpmvdnwtppryfnmmfqdlrgprggrgllaylrpe
    taqgifvnfknvldatsrklgfgiaqigkafrneitprnfifrvrefeqmeieyfvrpge
    deywhrywveerlkwwqemglsrenlvpyqqppessahyakatvdilyrfphgslelegi
    aqrtdfdlgshtkdqealgitarvlrnehstqrlayrdpetgkwfvpyviepsagvdrgv
    lallaeaftreelpngeerivlklkpqlapikvaviplvknrpeiteyakrlkarllalg
    lgrvlyedtgnigkayrrhdevgtpfavtvdydtigqskdgttrlkdtvtvrdrdtmeqi
    rlhvdelegflrerlrw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1atiB (B:)
    aassldelvalckrrgfifqsseiygglqgvydygplgvelknnlkqawwrrnvyerddm
    egldasvlthrlvlhysgheatfadpmvdnritkkryrldhllkeqpeevlkrlyramev
    eeenlhalvqammqaperaggamtaagvldpasgepgdwtppryfnmmfqdlrgprggrg
    llaylrpetaqgifvnfknvldatsrklgfgiaqigkafrneitprnfifrvrefeqmei
    eyfvrpgedeywhrywveerlkwwqemglsrenlvpyqqppessahyakatvdilyrfph
    gslelegiaqrtdfdlgshtkdqealgitarvlrnehstqrlayrdpetgkwfvpyviep
    sagvdrgvlallaeaftreelpngeerivlklkpqlapikvaviplvknrpeiteyakrl
    karllalglgrvlyedtgnigkayrrhdevgtpfavtvdydtigqskdgttrlkdtvtvr
    drdtmeqirlhvdelegflrerlrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1atiB (B:)
    aassldelvalckrrgfifqsseiygglqgvydygplgvelknnlkqawwrrnvyerddm
    egldasvlthrlvlhysgheatfadpmvdwtppryfnmmfqdlrgprggrgllaylrpet
    aqgifvnfknvldatsrklgfgiaqigkafrneitprnfifrvrefeqmeieyfvrpged
    eywhrywveerlkwwqemglsrenlvpyqqppessahyakatvdilyrfphgslelegia
    qrtdfdlgshtkdqealgitarvlrnehstqrlayrdpetgkwfvpyviepsagvdrgvl
    allaeaftreelpngeerivlklkpqlapikvaviplvknrpeiteyakrlkarllalgl
    grvlyedtgnigkayrrhdevgtpfavtvdydtigqskdgttrlkdtvtvrdrdtmeqir
    lhvdelegflrerlrw