| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) ![]() same topology as (b.1.15.1) |
| Family b.1.30.0: automated matches [254306] (1 protein) not a true family |
| Protein automated matches [254707] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255965] (16 PDB entries) |
| Domain d5j6sb3: 5j6s B:547-637 [331021] Other proteins in same PDB: d5j6sa1, d5j6sa2, d5j6sa4, d5j6sa5, d5j6sb1, d5j6sb2, d5j6sb4, d5j6sb5 automated match to d3se6a3 complexed with 6ga, bma, man, nag, zn |
PDB Entry: 5j6s (more details), 2.8 Å
SCOPe Domain Sequences for d5j6sb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5j6sb3 b.1.30.0 (B:547-637) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipllvvkqdgcslrlqqerflqgvfqedpewralqerylwhipltystsssnvihrhilk
sktdtldlpektswvkfnvdsngyyivhyeg
Timeline for d5j6sb3: