Lineage for d3se6a3 (3se6 A:547-637)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2040155Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2040177Family b.1.30.0: automated matches [254306] (1 protein)
    not a true family
  6. 2040178Protein automated matches [254707] (4 species)
    not a true protein
  7. 2040179Species Human (Homo sapiens) [TaxId:9606] [255965] (16 PDB entries)
  8. 2040192Domain d3se6a3: 3se6 A:547-637 [249387]
    Other proteins in same PDB: d3se6a1, d3se6a2, d3se6a4, d3se6a5, d3se6b1, d3se6b2, d3se6b4, d3se6b5
    automated match to d2yd0a3
    complexed with lys, mes, nag, zn

Details for d3se6a3

PDB Entry: 3se6 (more details), 3.08 Å

PDB Description: crystal structure of the human endoplasmic reticulum aminopeptidase 2
PDB Compounds: (A:) Endoplasmic reticulum aminopeptidase 2

SCOPe Domain Sequences for d3se6a3:

Sequence, based on SEQRES records: (download)

>d3se6a3 b.1.30.0 (A:547-637) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipllvvkqdgcslrlqqerflqgvfqedpewralqerylwhipltystsssnvihrhilk
sktdtldlpektswvkfnvdsngyyivhyeg

Sequence, based on observed residues (ATOM records): (download)

>d3se6a3 b.1.30.0 (A:547-637) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipllvvkqdgcslrlqqerflqgqerylwhipltystsssnvihrhilksktdtldlpek
tswvkfnvdsngyyivhyeg

SCOPe Domain Coordinates for d3se6a3:

Click to download the PDB-style file with coordinates for d3se6a3.
(The format of our PDB-style files is described here.)

Timeline for d3se6a3: