Lineage for d5j6sa4 (5j6s A:638-960)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2009600Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2010204Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2010205Protein automated matches [190220] (14 species)
    not a true protein
  7. 2010232Species Human (Homo sapiens) [TaxId:9606] [189070] (42 PDB entries)
  8. 2010284Domain d5j6sa4: 5j6s A:638-960 [331034]
    Other proteins in same PDB: d5j6sa1, d5j6sa2, d5j6sa3, d5j6sa5, d5j6sb1, d5j6sb2, d5j6sb3, d5j6sb5
    automated match to d3se6a4
    complexed with 6ga, bma, man, nag, zn

Details for d5j6sa4

PDB Entry: 5j6s (more details), 2.8 Å

PDB Description: crystal structure of endoplasmic reticulum aminopeptidase 2 (erap2) in complex with a hydroxamic derivative ligand
PDB Compounds: (A:) Endoplasmic reticulum aminopeptidase 2

SCOPe Domain Sequences for d5j6sa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j6sa4 a.118.1.0 (A:638-960) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hgwdqlitqlnqnhtllrpkdrvglihdvfqlvgagrltldkaldmtyylqhetsspall
eglsylesfyhmmdrrnisdisenlkryllqyfkpvidrqswsdkgsvwdrmlrsallkl
acdlnhapciqkaaelfsqwmessgklniptdvlkivysvgaqttagwnylleqyelsms
saeqnkilyalstskhqekllklielgmegkviktqnlaallhaiarrpkgqqlawdfvr
enwthllkkfdlgsydirmiisgttahfsskdklqevklffesleaqgshldifqtvlet
itknikwleknlptlrtwlmvnt

SCOPe Domain Coordinates for d5j6sa4:

Click to download the PDB-style file with coordinates for d5j6sa4.
(The format of our PDB-style files is described here.)

Timeline for d5j6sa4: