Lineage for d5j6sb3 (5j6s B:547-637)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2376781Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2376803Family b.1.30.0: automated matches [254306] (1 protein)
    not a true family
  6. 2376804Protein automated matches [254707] (4 species)
    not a true protein
  7. 2376805Species Human (Homo sapiens) [TaxId:9606] [255965] (22 PDB entries)
  8. 2376837Domain d5j6sb3: 5j6s B:547-637 [331021]
    Other proteins in same PDB: d5j6sa1, d5j6sa2, d5j6sa4, d5j6sa5, d5j6sb1, d5j6sb2, d5j6sb4, d5j6sb5
    automated match to d3se6a3
    complexed with 6ga, bma, man, nag, zn

Details for d5j6sb3

PDB Entry: 5j6s (more details), 2.8 Å

PDB Description: crystal structure of endoplasmic reticulum aminopeptidase 2 (erap2) in complex with a hydroxamic derivative ligand
PDB Compounds: (B:) Endoplasmic reticulum aminopeptidase 2

SCOPe Domain Sequences for d5j6sb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j6sb3 b.1.30.0 (B:547-637) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipllvvkqdgcslrlqqerflqgvfqedpewralqerylwhipltystsssnvihrhilk
sktdtldlpektswvkfnvdsngyyivhyeg

SCOPe Domain Coordinates for d5j6sb3:

Click to download the PDB-style file with coordinates for d5j6sb3.
(The format of our PDB-style files is described here.)

Timeline for d5j6sb3: