Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
Protein automated matches [190805] (18 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188286] (68 PDB entries) |
Domain d5j6sa2: 5j6s A:272-546 [331032] Other proteins in same PDB: d5j6sa1, d5j6sa3, d5j6sa4, d5j6sa5, d5j6sb1, d5j6sb3, d5j6sb4, d5j6sb5 automated match to d3se6a2 complexed with 6ga, bma, man, nag, zn |
PDB Entry: 5j6s (more details), 2.8 Å
SCOPe Domain Sequences for d5j6sa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5j6sa2 d.92.1.0 (A:272-546) automated matches {Human (Homo sapiens) [TaxId: 9606]} hslsgftssgvkvsiyaspdkrnqthyalqaslklldfyekyfdiyyplskldliaipdf apgamenwglityretsllfdpktssasdklwvtrviahelahqwfgnlvtmewwndiwl negfakymeliavnatypelqfddyflnvcfevitkdslnssrpiskpaetptqiqemfd evsynkgacilnmlkdflgeekfqkgiiqylkkfsyrnaknddlwsslsnsclesdftsg gvchsdpkmtsnmlaflgenaevkemmttwtlqkg
Timeline for d5j6sa2: