Lineage for d1c72c2 (1c72 C:1-84)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 123181Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 123182Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 123318Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 123330Protein Glutathione S-transferase [52863] (24 species)
  7. 123331Species Chicken (Gallus gallus), class mu [52869] (2 PDB entries)
  8. 123336Domain d1c72c2: 1c72 C:1-84 [32959]
    Other proteins in same PDB: d1c72a1, d1c72b1, d1c72c1, d1c72d1

Details for d1c72c2

PDB Entry: 1c72 (more details), 2.8 Å

PDB Description: tyr115, gln165 and trp209 contribute to the 1,2-epoxy-3-(p-nitrophenoxy)propane conjugating activities of glutathione s-transferase cgstm1-1

SCOP Domain Sequences for d1c72c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c72c2 c.47.1.5 (C:1-84) Glutathione S-transferase {Chicken (Gallus gallus), class mu}
vvtlgywdirglahairllleytetpyqerrykagpapdfdpsdwtnekeklgldfpnlp
ylidgdvkltqsnailryiarkhn

SCOP Domain Coordinates for d1c72c2:

Click to download the PDB-style file with coordinates for d1c72c2.
(The format of our PDB-style files is described here.)

Timeline for d1c72c2: