Lineage for d1c72b1 (1c72 B:85-217)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97949Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 97950Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 97951Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 97963Protein Glutathione S-transferase [47618] (24 species)
  7. 97964Species Chicken (Gallus gallus), class mu [47624] (2 PDB entries)
  8. 97968Domain d1c72b1: 1c72 B:85-217 [17664]
    Other proteins in same PDB: d1c72a2, d1c72b2, d1c72c2, d1c72d2

Details for d1c72b1

PDB Entry: 1c72 (more details), 2.8 Å

PDB Description: tyr115, gln165 and trp209 contribute to the 1,2-epoxy-3-(p-nitrophenoxy)propane conjugating activities of glutathione s-transferase cgstm1-1

SCOP Domain Sequences for d1c72b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c72b1 a.45.1.1 (B:85-217) Glutathione S-transferase {Chicken (Gallus gallus), class mu}
mcgetevekqrvdvlenhlmdlrmafarlcyspdfeklkpaylellpgklrqlsrflgsr
swfvgdkltfvdflaydvldqqrmfvpdcpelqgnlsqflqrfealekisaymrsgrfmk
apifwytalwnnk

SCOP Domain Coordinates for d1c72b1:

Click to download the PDB-style file with coordinates for d1c72b1.
(The format of our PDB-style files is described here.)

Timeline for d1c72b1: