SCOP 1.59: Domain d1c72c1: 1c72 C:85-217

Lineage for d1c72c1 (1c72 C:85-217)

Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds)
Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family)
Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
Protein Glutathione S-transferase [47618] (24 species)
Species Chicken (Gallus gallus), class mu [47624] (2 PDB entries)
Domain d1c72c1: 1c72 C:85-217 [17665]
Other proteins in same PDB: d1c72a2, d1c72b2, d1c72c2, d1c72d2

Details for d1c72c1

PDB Entry: 1c72 (more details), 2.8 Å

PDB Description: tyr115, gln165 and trp209 contribute to the 1,2-epoxy-3-(p-nitrophenoxy)propane conjugating activities of glutathione s-transferase cgstm1-1

SCOP Domain Sequences for d1c72c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c72c1 a.45.1.1 (C:85-217) Glutathione S-transferase {Chicken (Gallus gallus), class mu}
mcgetevekqrvdvlenhlmdlrmafarlcyspdfeklkpaylellpgklrqlsrflgsr
swfvgdkltfvdflaydvldqqrmfvpdcpelqgnlsqflqrfealekisaymrsgrfmk
apifwytalwnnk

SCOP Domain Coordinates for d1c72c1:

Click to download the PDB-style file with coordinates for d1c72c1.
(The format of our PDB-style files is described here.)

Timeline for d1c72c1: