Lineage for d1c72b1 (1c72 B:85-217)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713057Protein Class mu GST [81348] (3 species)
  7. 2713058Species Chicken (Gallus gallus) [TaxId:9031] [47624] (2 PDB entries)
  8. 2713062Domain d1c72b1: 1c72 B:85-217 [17664]
    Other proteins in same PDB: d1c72a2, d1c72b2, d1c72c2, d1c72d2
    complexed with epy

Details for d1c72b1

PDB Entry: 1c72 (more details), 2.8 Å

PDB Description: tyr115, gln165 and trp209 contribute to the 1,2-epoxy-3-(p-nitrophenoxy)propane conjugating activities of glutathione s-transferase cgstm1-1
PDB Compounds: (B:) protein (glutathione s-transferase)

SCOPe Domain Sequences for d1c72b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c72b1 a.45.1.1 (B:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]}
mcgetevekqrvdvlenhlmdlrmafarlcyspdfeklkpaylellpgklrqlsrflgsr
swfvgdkltfvdflaydvldqqrmfvpdcpelqgnlsqflqrfealekisaymrsgrfmk
apifwytalwnnk

SCOPe Domain Coordinates for d1c72b1:

Click to download the PDB-style file with coordinates for d1c72b1.
(The format of our PDB-style files is described here.)

Timeline for d1c72b1: