Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.47: Thioredoxin fold [52832] (3 superfamilies) |
Superfamily c.47.1: Thioredoxin-like [52833] (10 families) |
Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins) |
Protein Glutathione S-transferase [52863] (22 species) |
Species Chicken (Gallus gallus), class mu [52869] (2 PDB entries) |
Domain d1c72c2: 1c72 C:1-84 [32959] Other proteins in same PDB: d1c72a1, d1c72b1, d1c72c1, d1c72d1 |
PDB Entry: 1c72 (more details), 2.8 Å
SCOP Domain Sequences for d1c72c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c72c2 c.47.1.5 (C:1-84) Glutathione S-transferase {Chicken (Gallus gallus), class mu} vvtlgywdirglahairllleytetpyqerrykagpapdfdpsdwtnekeklgldfpnlp ylidgdvkltqsnailryiarkhn
Timeline for d1c72c2: