| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) ![]() bind purine or pterin in topologically similar sites between subunits |
| Family d.96.1.0: automated matches [227243] (1 protein) not a true family |
| Protein automated matches [227009] (13 species) not a true protein |
| Species Danio rerio [TaxId:7955] [327451] (2 PDB entries) |
| Domain d5ll1d2: 5ll1 D:143-294 [329089] automated match to d4n9sa2 |
PDB Entry: 5ll1 (more details), 2.8 Å
SCOPe Domain Sequences for d5ll1d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ll1d2 d.96.1.0 (D:143-294) automated matches {Danio rerio [TaxId: 7955]}
sktpvvhsglkdmkvlkttqtgfegflrdrfttltdakdrffctsvyarwryntinvafd
aawkavkdtviqkfagpydrgeyspsvqktlydtqllvldripeveeieiimpnqhyfvi
dmtkiglsnkdevylpldnpsgnitgtvcrkp
Timeline for d5ll1d2: