SCOPe 2.06: Domain d5ll1f2: 5ll1 F:143-294

Lineage for d5ll1f2 (5ll1 F:143-294)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.0: automated matches [227243] (1 protein)
   not a true family

6. Protein automated matches [227009] (13 species)
   not a true protein

7. Species Danio rerio [TaxId:7955] [327451] (2 PDB entries)

8. Domain d5ll1f2: 5ll1 F:143-294 [328993]
   automated match to d4n9sa2

Details for d5ll1f2

PDB Entry: 5ll1, 2.8 Å

PDB Description: crystal structure of urate oxidase from zebrafish

PDB Compounds: (F:) Uricase

SCOPe Domain Sequences for d5ll1f2:

Sequence; same for both SEQRES and ATOM records:

>d5ll1f2 d.96.1.0 (F:143-294) automated matches {Danio rerio [TaxId: 7955]}
sktpvvhsglkdmkvlkttqtgfegflrdrfttltdakdrffctsvyarwryntinvafd
aawkavkdtviqkfagpydrgeyspsvqktlydtqllvldripeveeieiimpnqhyfvi
dmtkiglsnkdevylpldnpsgnitgtvcrkp

Timeline for d5ll1f2:

• d5ll1f2 is new in SCOPe 2.06-stable
  
• d5ll1f2 appears in SCOPe 2.07
  
• d5ll1f2 appears in the current release, SCOPe 2.08