Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) |
Protein 2Fe-2S ferredoxin [54294] (19 species) |
Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (20 PDB entries) |
Domain d5gxgb_: 5gxg B: [328466] Other proteins in same PDB: d5gxga_ automated match to d4jwsc_ complexed with dtt, fes, hem, so4 |
PDB Entry: 5gxg (more details), 1.7 Å
SCOPe Domain Sequences for d5gxgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gxgb_ d.15.4.1 (B:) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv paanereigmlecvtaelkpnsrlccqiimtpeldgivvdvpdrqw
Timeline for d5gxgb_: