Lineage for d4jwsc_ (4jws C:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. Protein 2Fe-2S ferredoxin [54294] (19 species)
  7. Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (20 PDB entries)
  8. Domain d4jwsc_: 4jws C: [202815]
    Other proteins in same PDB: d4jwsa_, d4jwsb_
    automated match to d4jwsd_
    complexed with 1n0, ca, fes, hem

Details for d4jwsc_

PDB Entry: 4jws (more details), 2.15 Å

PDB Description: Crystal structure of Cytochrome P450cam-putidaredoxin complex
PDB Compounds: (C:) putidaredoxin

SCOPe Domain Sequences for d4jwsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jwsc_ d.15.4.1 (C:) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]}
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlecvtaelkpnsrlccqiimtpeldgivvdvpdrqw

SCOPe Domain Coordinates for d4jwsc_ are not available.

Timeline for d4jwsc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4jwsa_, d4jwsb_, d4jwsd_