PDB entry 5gxg

View 5gxg on RCSB PDB site
Description: High-resolution crystal structure of the electron transfer complex of cytochrome p450cam with putidaredoxin
Class: oxidoreductase/electron transport
Keywords: inter-protein electron transfer, oxidoreductase-electron transport complex
Deposited on 2016-09-17, released 2017-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Camphor 5-monooxygenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMC, CYP101
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (Start-415)
      • engineered mutation (127)
      • engineered mutation (131)
      • engineered mutation (335)
    Domains in SCOPe 2.07: d5gxga_
  • Chain 'B':
    Compound: putidaredoxin
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gxgb_
  • Heterogens: HEM, SO4, DTT, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gxgA (A:)
    mgttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrc
    ngghwiatrgqlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqv
    vgmpvvdclenciqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlk
    yltdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdea
    krmcglllvggldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadg
    riltsdyefhgvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlcl
    gqhlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gxgA (A:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
    lireayedyrhfssecpfipreydfiptsmdppeqrqfralanqvvgmpvvdclenciqe
    lacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgsmtf
    aeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggldtv
    vnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhgvqlk
    kgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiivtlke
    wltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gxgB (B:)
    mgskvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftd
    kvpaanereigmlecvtaelkpnsrlccqiimtpeldgivvdvpdrqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gxgB (B:)
    skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
    paanereigmlecvtaelkpnsrlccqiimtpeldgivvdvpdrqw