SCOPe 2.06: Domain d5gxgb_: 5gxg B:

Lineage for d5gxgb_ (5gxg B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)

6. Protein 2Fe-2S ferredoxin [54294] (19 species)

7. Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (19 PDB entries)

8. Domain d5gxgb_: 5gxg B: [328466]
   Other proteins in same PDB: d5gxga_
   automated match to d4jwsc_
   complexed with dtt, fes, hem, so4

Details for d5gxgb_

PDB Entry: 5gxg, 1.7 Å

PDB Description: high-resolution crystal structure of the electron transfer complex of cytochrome p450cam with putidaredoxin

PDB Compounds: (B:) putidaredoxin

SCOPe Domain Sequences for d5gxgb_:

Sequence; same for both SEQRES and ATOM records:

>d5gxgb_ d.15.4.1 (B:) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]}
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlecvtaelkpnsrlccqiimtpeldgivvdvpdrqw

Timeline for d5gxgb_:

• d5gxgb_ is new in SCOPe 2.06-stable
  
• d5gxgb_ appears in SCOPe 2.07
  
• d5gxgb_ appears in the current release, SCOPe 2.08