SCOP 1.55: Domain d13gsb2: 13gs B:2-76

Lineage for d13gsb2 (13gs B:2-76)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.47: Thioredoxin fold [52832] (3 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (10 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)

6. Protein Glutathione S-transferase [52863] (22 species)

7. Species Human (Homo sapiens), class pi [TaxId:9606] [52864] (30 PDB entries)

8. Domain d13gsb2: 13gs B:2-76 [32825]
   Other proteins in same PDB: d13gsa1, d13gsb1

Details for d13gsb2

PDB Entry: 13gs, 1.9 Å

PDB Description: glutathione s-transferase complexed with sulfasalazine

SCOP Domain Sequences for d13gsb2:

Sequence; same for both SEQRES and ATOM records:

>d13gsb2 c.47.1.5 (B:2-76) Glutathione S-transferase {Human (Homo sapiens), class pi}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtl

Timeline for d13gsb2:

• d13gsb2 appears in SCOP 1.57
  
• d13gsb2 appears in the current release, SCOPe 2.08