SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d13gsb2 (13gs B:2-76)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2117361Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 protein domains)
  6. 2117676Protein Class pi GST [81358] (4 species)
  7. 2117677Species Human (Homo sapiens) [TaxId:9606] [52864] (55 PDB entries)
  8. 2117755Domain d13gsb2: 13gs B:2-76 [32825]
    Other proteins in same PDB: d13gsa1, d13gsb1
    complexed with gsh, mes, sas

Details for d13gsb2

PDB Entry: 13gs (more details), 1.9 Å

PDB Description: glutathione s-transferase complexed with sulfasalazine
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d13gsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d13gsb2 c.47.1.5 (B:2-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtl

SCOPe Domain Coordinates for d13gsb2:

Click to download the PDB-style file with coordinates for d13gsb2.
(The format of our PDB-style files is described here.)

Timeline for d13gsb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d13gsb1