Lineage for d13gsb2 (13gs B:2-76)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876589Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2876959Protein Class pi GST [81358] (4 species)
  7. 2876960Species Human (Homo sapiens) [TaxId:9606] [52864] (64 PDB entries)
  8. 2877034Domain d13gsb2: 13gs B:2-76 [32825]
    Other proteins in same PDB: d13gsa1, d13gsb1
    complexed with gsh, mes, sas

Details for d13gsb2

PDB Entry: 13gs (more details), 1.9 Å

PDB Description: glutathione s-transferase complexed with sulfasalazine
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d13gsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d13gsb2 c.47.1.5 (B:2-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtl

SCOPe Domain Coordinates for d13gsb2:

Click to download the PDB-style file with coordinates for d13gsb2.
(The format of our PDB-style files is described here.)

Timeline for d13gsb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d13gsb1