Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein automated matches [190224] (17 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [260543] (10 PDB entries) |
Domain d5kafd_: 5kaf D: [327776] Other proteins in same PDB: d5kafb_, d5kafc_, d5kafe_, d5kaff_, d5kafh_, d5kafi1, d5kafi2, d5kafj_, d5kafk_, d5kafl_, d5kafm1, d5kafm2, d5kafo_, d5kaft1, d5kaft2, d5kafu_, d5kafv_, d5kafx_, d5kafz_ automated match to d3wu2d_ complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl |
PDB Entry: 5kaf (more details), 3 Å
SCOPe Domain Sequences for d5kafd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kafd_ f.26.1.1 (D:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} rgwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegc nfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfe iarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnw tlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanr fwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpef etfytknlllnegirawmapqdqphenfvfpeevlprgnal
Timeline for d5kafd_: