Lineage for d5kafd_ (5kaf D:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027280Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 3027281Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 3027282Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 3027502Protein automated matches [190224] (17 species)
    not a true protein
  7. 3027611Species Thermosynechococcus elongatus [TaxId:197221] [260543] (10 PDB entries)
  8. 3027625Domain d5kafd_: 5kaf D: [327776]
    Other proteins in same PDB: d5kafb_, d5kafc_, d5kafe_, d5kaff_, d5kafh_, d5kafi1, d5kafi2, d5kafj_, d5kafk_, d5kafl_, d5kafm1, d5kafm2, d5kafo_, d5kaft1, d5kaft2, d5kafu_, d5kafv_, d5kafx_, d5kafz_
    automated match to d3wu2d_
    complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kafd_

PDB Entry: 5kaf (more details), 3 Å

PDB Description: rt xfel structure of photosystem ii in the dark state at 3.0 a resolution
PDB Compounds: (D:) Photosystem II D2 protein

SCOPe Domain Sequences for d5kafd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kafd_ f.26.1.1 (D:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
rgwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegc
nfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfe
iarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnw
tlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanr
fwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpef
etfytknlllnegirawmapqdqphenfvfpeevlprgnal

SCOPe Domain Coordinates for d5kafd_:

Click to download the PDB-style file with coordinates for d5kafd_.
(The format of our PDB-style files is described here.)

Timeline for d5kafd_: