Lineage for d3wu2d_ (3wu2 D:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027280Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 3027281Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 3027282Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 3027502Protein automated matches [190224] (17 species)
    not a true protein
  7. 3027631Species Thermosynechococcus vulcanus [TaxId:32053] [189911] (27 PDB entries)
  8. 3027637Domain d3wu2d_: 3wu2 D: [259616]
    Other proteins in same PDB: d3wu2b_, d3wu2c_, d3wu2e_, d3wu2f_, d3wu2h_, d3wu2i_, d3wu2j_, d3wu2k_, d3wu2l_, d3wu2m_, d3wu2o_, d3wu2t_, d3wu2u_, d3wu2v_, d3wu2x_, d3wu2z_
    automated match to d3arcd_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, so4, sqd, unl

Details for d3wu2d_

PDB Entry: 3wu2 (more details), 1.9 Å

PDB Description: crystal structure analysis of photosystem ii complex
PDB Compounds: (D:) Photosystem II D2 protein

SCOPe Domain Sequences for d3wu2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wu2d_ f.26.1.1 (D:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
rgwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegc
nfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfe
iarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnw
tlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanr
fwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpef
etfytknlllnegirawmapqdqpxenfvfpeevlprgnal

SCOPe Domain Coordinates for d3wu2d_:

Click to download the PDB-style file with coordinates for d3wu2d_.
(The format of our PDB-style files is described here.)

Timeline for d3wu2d_: