SCOPe 2.07: Domain d3wu2d_: 3wu2 D:

Lineage for d3wu2d_ (3wu2 D:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (14 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189911] (26 PDB entries)

8. Domain d3wu2d_: 3wu2 D: [259616]
   Other proteins in same PDB: d3wu2b_, d3wu2c_, d3wu2e_, d3wu2f_, d3wu2h_, d3wu2i_, d3wu2j_, d3wu2k_, d3wu2l_, d3wu2m_, d3wu2o_, d3wu2t_, d3wu2u_, d3wu2v_, d3wu2x_, d3wu2z_
   automated match to d3arcd_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, so4, sqd, unl

Details for d3wu2d_

PDB Entry: 3wu2, 1.9 Å

PDB Description: crystal structure analysis of photosystem ii complex

PDB Compounds: (D:) Photosystem II D2 protein

SCOPe Domain Sequences for d3wu2d_:

Sequence; same for both SEQRES and ATOM records:

>d3wu2d_ f.26.1.1 (D:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
rgwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegc
nfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfe
iarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnw
tlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanr
fwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpef
etfytknlllnegirawmapqdqpxenfvfpeevlprgnal

Timeline for d3wu2d_:

• d3wu2d_ first appeared in SCOPe 2.04
  
• d3wu2d_ appears in SCOPe 2.06
  
• d3wu2d_ appears in the current release, SCOPe 2.08