SCOPe 2.08: Domain d5kafl_: 5kaf l:

Lineage for d5kafl_ (5kaf l:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family)
   automatically mapped to Pfam PF02419

5. Family f.23.31.1: PsbL-like [161018] (2 proteins)
   Pfam PF02419

6. Protein Photosystem II reaction center protein L, PsbL [161019] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:146786] [161020] (6 PDB entries)
   Uniprot Q8DIN8 1-37

8. Domain d5kafl_: 5kaf l: [326607]
   Other proteins in same PDB: d5kafa_, d5kafb_, d5kafc_, d5kafd_, d5kafe_, d5kaff_, d5kafh_, d5kafi1, d5kafi2, d5kafj_, d5kafk_, d5kafm1, d5kafm2, d5kafo_, d5kaft1, d5kaft2, d5kafu_, d5kafv_, d5kafx_, d5kafz_
   automated match to d2axtl1
   complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kafl_

PDB Entry: 5kaf, 3 Å

PDB Description: rt xfel structure of photosystem ii in the dark state at 3.0 a resolution

PDB Compounds: (l:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d5kafl_:

Sequence; same for both SEQRES and ATOM records:

>d5kafl_ f.23.31.1 (l:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus elongatus [TaxId: 146786]}
mepnpnrqpvelnrtslylglllilvlallfssyffn

Timeline for d5kafl_:

• d5kafl_ first appeared in SCOPe 2.06
  
• d5kafl_ appears in SCOPe 2.07