SCOPe 2.08: Domain d5kafa_: 5kaf A:

Lineage for d5kafa_ (5kaf A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (17 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [260543] (10 PDB entries)

8. Domain d5kafa_: 5kaf A: [327742]
   Other proteins in same PDB: d5kafb_, d5kafc_, d5kafe_, d5kaff_, d5kafh_, d5kafi1, d5kafi2, d5kafj_, d5kafk_, d5kafl_, d5kafm1, d5kafm2, d5kafo_, d5kaft1, d5kaft2, d5kafu_, d5kafv_, d5kafx_, d5kafz_
   automated match to d2axta1
   complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kafa_

PDB Entry: 5kaf, 3 Å

PDB Description: rt xfel structure of photosystem ii in the dark state at 3.0 a resolution

PDB Compounds: (A:) Photosystem II protein D1 1

SCOPe Domain Sequences for d5kafa_:

Sequence; same for both SEQRES and ATOM records:

>d5kafa_ f.26.1.1 (A:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
anlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsgs
llygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgrq
welsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqaeh
nilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetyniva
ahgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngfnfnhsvidak
gnvintwadiinranlgmevmhernahnfpldla

Timeline for d5kafa_:

• d5kafa_ first appeared in SCOPe 2.06
  
• d5kafa_ appears in SCOPe 2.07