Lineage for d5kx5b2 (5kx5 B:246-440)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959213Protein automated matches [227071] (7 species)
    not a true protein
  7. 2959964Species Sheep (Ovis aries) [TaxId:9940] [226224] (15 PDB entries)
  8. 2959997Domain d5kx5b2: 5kx5 B:246-440 [327673]
    Other proteins in same PDB: d5kx5b1, d5kx5c1, d5kx5d1, d5kx5e_, d5kx5f1, d5kx5f2, d5kx5f3
    automated match to d3rycd2
    complexed with 6yk, adp, ca, gdp, gtp, mg

Details for d5kx5b2

PDB Entry: 5kx5 (more details), 2.5 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-compound 11 complex
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d5kx5b2:

Sequence, based on SEQRES records: (download)

>d5kx5b2 d.79.2.1 (B:246-440) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdata

Sequence, based on observed residues (ATOM records): (download)

>d5kx5b2 d.79.2.1 (B:246-440) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgyraltvpeltqqmfdsknmmaacdpr
hgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsat
fignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyq
data

SCOPe Domain Coordinates for d5kx5b2:

Click to download the PDB-style file with coordinates for d5kx5b2.
(The format of our PDB-style files is described here.)

Timeline for d5kx5b2: