![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
![]() | Protein automated matches [227071] (7 species) not a true protein |
![]() | Species Sheep (Ovis aries) [TaxId:9940] [226224] (15 PDB entries) |
![]() | Domain d5kx5c2: 5kx5 C:246-440 [327648] Other proteins in same PDB: d5kx5b1, d5kx5c1, d5kx5d1, d5kx5e_, d5kx5f1, d5kx5f2, d5kx5f3 automated match to d4i50a2 complexed with 6yk, adp, ca, gdp, gtp, mg |
PDB Entry: 5kx5 (more details), 2.5 Å
SCOPe Domain Sequences for d5kx5c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kx5c2 d.79.2.1 (C:246-440) automated matches {Sheep (Ovis aries) [TaxId: 9940]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgvdsv
Timeline for d5kx5c2: