![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
![]() | Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
![]() | Protein automated matches [226837] (9 species) not a true protein |
![]() | Species Sheep (Ovis aries) [TaxId:9940] [224884] (15 PDB entries) |
![]() | Domain d5kx5b1: 5kx5 B:1-245 [327672] Other proteins in same PDB: d5kx5b2, d5kx5c2, d5kx5d2, d5kx5e_, d5kx5f1, d5kx5f2, d5kx5f3 automated match to d4drxb1 complexed with 6yk, adp, ca, gdp, gtp, mg |
PDB Entry: 5kx5 (more details), 2.5 Å
SCOPe Domain Sequences for d5kx5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kx5b1 c.32.1.1 (B:1-245) automated matches {Sheep (Ovis aries) [TaxId: 9940]} mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv epynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttcl rfp
Timeline for d5kx5b1: