SCOPe 2.07: Domain d5kx5e_: 5kx5 E:

Lineage for d5kx5e_ (5kx5 E:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.10: Stathmin [101494] (1 family)
   single long helix crosslinking four tubulin subunits
   automatically mapped to Pfam PF00836

5. Family a.137.10.1: Stathmin [101495] (2 proteins)

6. Protein Stathmin 4 [101496] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (97 PDB entries)

8. Domain d5kx5e_: 5kx5 E: [327711]
   Other proteins in same PDB: d5kx5b1, d5kx5b2, d5kx5c1, d5kx5c2, d5kx5d1, d5kx5d2, d5kx5f1, d5kx5f2, d5kx5f3
   automated match to d4i55e_
   complexed with 6yk, adp, ca, gdp, gtp, mg

Details for d5kx5e_

PDB Entry: 5kx5, 2.5 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-compound 11 complex

PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5kx5e_:

Sequence, based on SEQRES records:

>d5kx5e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkatsgqswevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records):

>d5kx5e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkatsgqswevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
e

Timeline for d5kx5e_:

• d5kx5e_ first appeared in SCOPe 2.06