SCOPe 2.06: Domain d5h4ib_: 5h4i B:

Lineage for d5h4ib_ (5h4i B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein automated matches [190658] (6 species)
   not a true protein

7. Species Zika virus [TaxId:64320] [327129] (2 PDB entries)

8. Domain d5h4ib_: 5h4i B: [327175]
   Other proteins in same PDB: d5h4ia_
   automated match to d3e90b_
   complexed with 7hq, act

Details for d5h4ib_

PDB Entry: 5h4i, 2 Å

PDB Description: unlinked ns2b-ns3 protease from zika virus in complex with a compound fragment

PDB Compounds: (B:) NS3 protease

SCOPe Domain Sequences for d5h4ib_:

Sequence; same for both SEQRES and ATOM records:

>d5h4ib_ b.47.1.3 (B:) automated matches {Zika virus [TaxId: 64320]}
ettdgvyrvmtrrllgstqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgdvkqdl
vsycgpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagtsg
spildkcgrviglygngvvikngsyvsaitqgkre

Timeline for d5h4ib_:

• d5h4ib_ is new in SCOPe 2.06-stable
  
• d5h4ib_ appears in SCOPe 2.07
  
• d5h4ib_ appears in the current release, SCOPe 2.08