SCOPe 2.06: Domain d5h4ia_: 5h4i A:

Lineage for d5h4ia_ (5h4i A:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily)

4. Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families)
   Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex

5. Family g.96.1.0: automated matches [324385] (1 protein)
   not a true family

6. Protein automated matches [324386] (2 species)
   not a true protein

7. Species Zika virus [TaxId:64320] [327137] (3 PDB entries)

8. Domain d5h4ia_: 5h4i A: [327163]
   Other proteins in same PDB: d5h4ib_
   automated match to d2ggva_
   complexed with 7hq, act

Details for d5h4ia_

PDB Entry: 5h4i, 2 Å

PDB Description: unlinked ns2b-ns3 protease from zika virus in complex with a compound fragment

PDB Compounds: (A:) NS2B cofactor

SCOPe Domain Sequences for d5h4ia_:

Sequence; same for both SEQRES and ATOM records:

>d5h4ia_ g.96.1.0 (A:) automated matches {Zika virus [TaxId: 64320]}
dmyieragditwekdaevtgnsprldvaldesgdfslv

Timeline for d5h4ia_:

• d5h4ia_ is new in SCOPe 2.06-stable
  
• d5h4ia_ appears in SCOPe 2.07
  
• d5h4ia_ appears in the current release, SCOPe 2.08