Lineage for d2ggva_ (2ggv A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2265381Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily)
  4. 2265382Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families) (S)
    Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex
  5. 2265383Family g.96.1.1: Flavivirus non-structural protein NS2B-like [310635] (2 proteins)
  6. 2265389Protein automated matches [310851] (1 species)
    not a true protein
  7. 2265390Species West Nile virus [TaxId:11082] [311209] (3 PDB entries)
  8. 2265391Domain d2ggva_: 2ggv A: [287270]
    Other proteins in same PDB: d2ggvb_
    automated match to d2fp7a_
    mutant

Details for d2ggva_

PDB Entry: 2ggv (more details), 1.8 Å

PDB Description: crystal structure of the west nile virus ns2b-ns3 protease, his51ala mutant
PDB Compounds: (A:) non-structural protein 2B

SCOPe Domain Sequences for d2ggva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ggva_ g.96.1.1 (A:) automated matches {West Nile virus [TaxId: 11082]}
tdmwiertadiswesdaeitgsservdvrldddgnfqlmndpga

SCOPe Domain Coordinates for d2ggva_:

Click to download the PDB-style file with coordinates for d2ggva_.
(The format of our PDB-style files is described here.)

Timeline for d2ggva_:

2265391
d2ggva_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d2ggvb_