| Class g: Small proteins [56992] (98 folds) |
| Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily) |
Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families) ![]() Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex |
| Family g.96.1.0: automated matches [324385] (1 protein) not a true family |
| Protein automated matches [324386] (3 species) not a true protein |
| Species Zika virus [TaxId:64320] [327137] (14 PDB entries) |
| Domain d5h4ia_: 5h4i A: [327163] Other proteins in same PDB: d5h4ib_ automated match to d2ggva_ complexed with 7hq, act |
PDB Entry: 5h4i (more details), 2 Å
SCOPe Domain Sequences for d5h4ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h4ia_ g.96.1.0 (A:) automated matches {Zika virus [TaxId: 64320]}
dmyieragditwekdaevtgnsprldvaldesgdfslv
Timeline for d5h4ia_: