![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.3: Viral proteases [50596] (5 proteins) beta sheet in the first domain is opened rather than forms a barrel |
![]() | Protein automated matches [190658] (12 species) not a true protein |
![]() | Species Zika virus [TaxId:64320] [327129] (7 PDB entries) |
![]() | Domain d5h4ib_: 5h4i B: [327175] Other proteins in same PDB: d5h4ia_ automated match to d3e90b_ complexed with 7hq, act |
PDB Entry: 5h4i (more details), 2 Å
SCOPe Domain Sequences for d5h4ib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h4ib_ b.47.1.3 (B:) automated matches {Zika virus [TaxId: 64320]} ettdgvyrvmtrrllgstqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgdvkqdl vsycgpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagtsg spildkcgrviglygngvvikngsyvsaitqgkre
Timeline for d5h4ib_: