Lineage for d5h4ib_ (5h4i B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2406625Family b.47.1.3: Viral proteases [50596] (5 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 2406715Protein automated matches [190658] (12 species)
    not a true protein
  7. 2406844Species Zika virus [TaxId:64320] [327129] (7 PDB entries)
  8. 2406859Domain d5h4ib_: 5h4i B: [327175]
    Other proteins in same PDB: d5h4ia_
    automated match to d3e90b_
    complexed with 7hq, act

Details for d5h4ib_

PDB Entry: 5h4i (more details), 2 Å

PDB Description: unlinked ns2b-ns3 protease from zika virus in complex with a compound fragment
PDB Compounds: (B:) NS3 protease

SCOPe Domain Sequences for d5h4ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h4ib_ b.47.1.3 (B:) automated matches {Zika virus [TaxId: 64320]}
ettdgvyrvmtrrllgstqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgdvkqdl
vsycgpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagtsg
spildkcgrviglygngvvikngsyvsaitqgkre

SCOPe Domain Coordinates for d5h4ib_:

Click to download the PDB-style file with coordinates for d5h4ib_.
(The format of our PDB-style files is described here.)

Timeline for d5h4ib_: