Lineage for d5tw7b1 (5tw7 B:2-197)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2859252Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 2859253Protein automated matches [190197] (23 species)
    not a true protein
  7. 2859431Species Neisseria gonorrhoeae [TaxId:485] [326531] (1 PDB entry)
  8. 2859433Domain d5tw7b1: 5tw7 B:2-197 [326580]
    Other proteins in same PDB: d5tw7a2, d5tw7a3, d5tw7b2, d5tw7b3, d5tw7c2, d5tw7c3, d5tw7c4, d5tw7d2, d5tw7d3, d5tw7e2, d5tw7e3, d5tw7f2, d5tw7f3, d5tw7f4
    automated match to d1gpma2
    complexed with mg

Details for d5tw7b1

PDB Entry: 5tw7 (more details), 2.35 Å

PDB Description: crystal structure of a gmp synthase (glutamine-hydrolyzing) from neisseria gonorrhoeae
PDB Compounds: (B:) GMP synthase [glutamine-hydrolyzing]

SCOPe Domain Sequences for d5tw7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tw7b1 c.23.16.0 (B:2-197) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
tqdkilildfgsqvtrliarrvreahvycelhsfdmpldeikafnpkgiilsggpnsvye
sdyqadtgifdlgipvlgicygmqfmahhlggevqpgnqrefgyaqvktidsgltrgiqd
dapntldvwmshgdkvsklpdgfavigdtpscpiammentekqfygiqfhpevthtkqgr
allnrfvldicgaqpg

SCOPe Domain Coordinates for d5tw7b1:

Click to download the PDB-style file with coordinates for d5tw7b1.
(The format of our PDB-style files is described here.)

Timeline for d5tw7b1: