Lineage for d5tw7a2 (5tw7 A:198-394)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861542Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 2861543Protein automated matches [190116] (28 species)
    not a true protein
  7. 2861639Species Neisseria gonorrhoeae [TaxId:485] [326533] (1 PDB entry)
  8. 2861640Domain d5tw7a2: 5tw7 A:198-394 [326543]
    Other proteins in same PDB: d5tw7a1, d5tw7a3, d5tw7b1, d5tw7b3, d5tw7c1, d5tw7c3, d5tw7c4, d5tw7d1, d5tw7d3, d5tw7e1, d5tw7e3, d5tw7f1, d5tw7f3, d5tw7f4
    automated match to d1gpma1
    complexed with mg

Details for d5tw7a2

PDB Entry: 5tw7 (more details), 2.35 Å

PDB Description: crystal structure of a gmp synthase (glutamine-hydrolyzing) from neisseria gonorrhoeae
PDB Compounds: (A:) GMP synthase [glutamine-hydrolyzing]

SCOPe Domain Sequences for d5tw7a2:

Sequence, based on SEQRES records: (download)

>d5tw7a2 c.26.2.0 (A:198-394) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
wtmpnyieeavakireqvgsdevilglsggvdssvaaalihraigdqltcvfvdhgllrl
negkmvmdmfarnlgvkvihvdaegqfmaklagvtdpekkrkiigaefievfdaeekklt
nakwlaqgtiypdviesagaktkkahaikshhnvgglpenmklklleplrdlfkdevrel
gvalglpremvyrhpfp

Sequence, based on observed residues (ATOM records): (download)

>d5tw7a2 c.26.2.0 (A:198-394) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
wtmpnyieeavakireqvgsdevilglsggvdssvaaalihraigdqltcvfvdhgllrl
negkmvmdmfarnlgvkvihvdaegqfmaklagvtdpekkrkiigaefievfdaeekklt
nakwlaqgtiypdviklklleplrdlfkdevrelgvalglpremvyrhpfp

SCOPe Domain Coordinates for d5tw7a2:

Click to download the PDB-style file with coordinates for d5tw7a2.
(The format of our PDB-style files is described here.)

Timeline for d5tw7a2: