| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
| Family c.26.2.0: automated matches [191320] (1 protein) not a true family |
| Protein automated matches [190116] (28 species) not a true protein |
| Species Neisseria gonorrhoeae [TaxId:485] [326533] (1 PDB entry) |
| Domain d5tw7a2: 5tw7 A:198-394 [326543] Other proteins in same PDB: d5tw7a1, d5tw7a3, d5tw7b1, d5tw7b3, d5tw7c1, d5tw7c3, d5tw7c4, d5tw7d1, d5tw7d3, d5tw7e1, d5tw7e3, d5tw7f1, d5tw7f3, d5tw7f4 automated match to d1gpma1 complexed with mg |
PDB Entry: 5tw7 (more details), 2.35 Å
SCOPe Domain Sequences for d5tw7a2:
Sequence, based on SEQRES records: (download)
>d5tw7a2 c.26.2.0 (A:198-394) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
wtmpnyieeavakireqvgsdevilglsggvdssvaaalihraigdqltcvfvdhgllrl
negkmvmdmfarnlgvkvihvdaegqfmaklagvtdpekkrkiigaefievfdaeekklt
nakwlaqgtiypdviesagaktkkahaikshhnvgglpenmklklleplrdlfkdevrel
gvalglpremvyrhpfp
>d5tw7a2 c.26.2.0 (A:198-394) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
wtmpnyieeavakireqvgsdevilglsggvdssvaaalihraigdqltcvfvdhgllrl
negkmvmdmfarnlgvkvihvdaegqfmaklagvtdpekkrkiigaefievfdaeekklt
nakwlaqgtiypdviklklleplrdlfkdevrelgvalglpremvyrhpfp
Timeline for d5tw7a2: