PDB entry 5tw7

View 5tw7 on RCSB PDB site
Description: Crystal structure of a GMP synthase (glutamine-hydrolyzing) from Neisseria gonorrhoeae
Class: ligase
Keywords: Neisseria gonorrhoeae, GMP, glutamine, structural genomics, NIAID, Seattle Structural Genomics Center for Infectious Disease, SSGCID, LIGASE
Deposited on 2016-11-11, released 2016-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GMP synthase [glutamine-hydrolyzing]
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: guaA, NGK_2643
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tw7a1, d5tw7a2, d5tw7a3
  • Chain 'B':
    Compound: GMP synthase [glutamine-hydrolyzing]
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: guaA, NGK_2643
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tw7b1, d5tw7b2, d5tw7b3
  • Chain 'C':
    Compound: GMP synthase [glutamine-hydrolyzing]
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: guaA, NGK_2643
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tw7c1, d5tw7c2, d5tw7c3, d5tw7c4
  • Chain 'D':
    Compound: GMP synthase [glutamine-hydrolyzing]
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: guaA, NGK_2643
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tw7d1, d5tw7d2, d5tw7d3
  • Chain 'E':
    Compound: GMP synthase [glutamine-hydrolyzing]
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: guaA, NGK_2643
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tw7e1, d5tw7e2, d5tw7e3
  • Chain 'F':
    Compound: GMP synthase [glutamine-hydrolyzing]
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: guaA, NGK_2643
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tw7f1, d5tw7f2, d5tw7f3, d5tw7f4
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tw7A (A:)
    mahhhhhhmtqdkilildfgsqvtrliarrvreahvycelhsfdmpldeikafnpkgiil
    sggpnsvyesdyqadtgifdlgipvlgicygmqfmahhlggevqpgnqrefgyaqvktid
    sgltrgiqddapntldvwmshgdkvsklpdgfavigdtpscpiammentekqfygiqfhp
    evthtkqgrallnrfvldicgaqpgwtmpnyieeavakireqvgsdevilglsggvdssv
    aaalihraigdqltcvfvdhgllrlnegkmvmdmfarnlgvkvihvdaegqfmaklagvt
    dpekkrkiigaefievfdaeekkltnakwlaqgtiypdviesagaktkkahaikshhnvg
    glpenmklklleplrdlfkdevrelgvalglpremvyrhpfpgpglgvrilgevkkeyad
    llrqaddifiqelrnttdengtswydltsqafavflpvksvgvmgdgrtydyvvalravi
    tsdfmtahwaelpysllgrvsnriinevkginrvvydvsgkppatiewe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tw7A (A:)
    qdkilildfgsqvtrliarrvreahvycelhsfdmpldeikafnpkgiilsggpnsvyes
    dyqadtgifdlgipvlgicygmqfmahhlggevqpgnqrefgyaqvktidsgltrgiqdd
    apntldvwmshgdkvsklpdgfavigdtpscpiammentekqfygiqfhpevthtkqgra
    llnrfvldicgaqpgwtmpnyieeavakireqvgsdevilglsggvdssvaaalihraig
    dqltcvfvdhgllrlnegkmvmdmfarnlgvkvihvdaegqfmaklagvtdpekkrkiig
    aefievfdaeekkltnakwlaqgtiypdviklklleplrdlfkdevrelgvalglpremv
    yrhpfpgpglgvrilgevkkeyadllrqaddifiqelrnttdengtswydltsqafavfl
    pvksvgvgrtydyvvalravitsdfmtahwaelpysllgrvsnriinevkginrvvydvs
    gkppatiewe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tw7B (B:)
    mahhhhhhmtqdkilildfgsqvtrliarrvreahvycelhsfdmpldeikafnpkgiil
    sggpnsvyesdyqadtgifdlgipvlgicygmqfmahhlggevqpgnqrefgyaqvktid
    sgltrgiqddapntldvwmshgdkvsklpdgfavigdtpscpiammentekqfygiqfhp
    evthtkqgrallnrfvldicgaqpgwtmpnyieeavakireqvgsdevilglsggvdssv
    aaalihraigdqltcvfvdhgllrlnegkmvmdmfarnlgvkvihvdaegqfmaklagvt
    dpekkrkiigaefievfdaeekkltnakwlaqgtiypdviesagaktkkahaikshhnvg
    glpenmklklleplrdlfkdevrelgvalglpremvyrhpfpgpglgvrilgevkkeyad
    llrqaddifiqelrnttdengtswydltsqafavflpvksvgvmgdgrtydyvvalravi
    tsdfmtahwaelpysllgrvsnriinevkginrvvydvsgkppatiewe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tw7B (B:)
    tqdkilildfgsqvtrliarrvreahvycelhsfdmpldeikafnpkgiilsggpnsvye
    sdyqadtgifdlgipvlgicygmqfmahhlggevqpgnqrefgyaqvktidsgltrgiqd
    dapntldvwmshgdkvsklpdgfavigdtpscpiammentekqfygiqfhpevthtkqgr
    allnrfvldicgaqpgwtmpnyieeavakireqvgsdevilglsggvdssvaaalihrai
    gdqltcvfvdhgllrlnegkmvmdmfarnlgvkvihvdaegqfmaklagvtdpekkrkii
    gaefievfdaeekkltnakwlaqgtiypdviklklleplrdlfkdevrelgvalglprem
    vyrhpfpgpglgvrilgevkkeyadllrqaddifiqelrnttdengtswydltsqafavf
    lpvksvgvrtydyvvalravitsdfmtahwaelpysllgrvsnriinevkginrvvydvs
    gkppatiewe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5tw7C (C:)
    mahhhhhhmtqdkilildfgsqvtrliarrvreahvycelhsfdmpldeikafnpkgiil
    sggpnsvyesdyqadtgifdlgipvlgicygmqfmahhlggevqpgnqrefgyaqvktid
    sgltrgiqddapntldvwmshgdkvsklpdgfavigdtpscpiammentekqfygiqfhp
    evthtkqgrallnrfvldicgaqpgwtmpnyieeavakireqvgsdevilglsggvdssv
    aaalihraigdqltcvfvdhgllrlnegkmvmdmfarnlgvkvihvdaegqfmaklagvt
    dpekkrkiigaefievfdaeekkltnakwlaqgtiypdviesagaktkkahaikshhnvg
    glpenmklklleplrdlfkdevrelgvalglpremvyrhpfpgpglgvrilgevkkeyad
    llrqaddifiqelrnttdengtswydltsqafavflpvksvgvmgdgrtydyvvalravi
    tsdfmtahwaelpysllgrvsnriinevkginrvvydvsgkppatiewe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tw7C (C:)
    mtqdkilildfgsqvtrliarrvreahvycelhsfdmpldeikafnpkgiilsggpnsvy
    esdyqadtgifdlgipvlgicygmqfmahhlggevqpgnqrefgyaqvktidsgltrgiq
    ddapntldvwmshgdkvsklpdgfavigdtpscpiammentekqfygiqfhpevthtkqg
    rallnrfvldicgaqpgwtmpnyieeavakireqvgsdevilglsggvdssvaaalihra
    igdqltcvfvdhgllrlnegkmvmdmfarnlgvkvihvdaegqfmaklagvtdpekkrki
    igaefievfdaeekkltnakwlaqgtiypdvieklklleplrdlfkdevrelgvalglpr
    emvyrhpfpgpglgvrilgevkkeyadllrqaddifiqelrnttdengtswydltsqafa
    vflpvksvgvrtydyvvalravitsdfmtahwaelpysllgrvsnriinevkginrvvyd
    vsgkppatiewe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5tw7D (D:)
    mahhhhhhmtqdkilildfgsqvtrliarrvreahvycelhsfdmpldeikafnpkgiil
    sggpnsvyesdyqadtgifdlgipvlgicygmqfmahhlggevqpgnqrefgyaqvktid
    sgltrgiqddapntldvwmshgdkvsklpdgfavigdtpscpiammentekqfygiqfhp
    evthtkqgrallnrfvldicgaqpgwtmpnyieeavakireqvgsdevilglsggvdssv
    aaalihraigdqltcvfvdhgllrlnegkmvmdmfarnlgvkvihvdaegqfmaklagvt
    dpekkrkiigaefievfdaeekkltnakwlaqgtiypdviesagaktkkahaikshhnvg
    glpenmklklleplrdlfkdevrelgvalglpremvyrhpfpgpglgvrilgevkkeyad
    llrqaddifiqelrnttdengtswydltsqafavflpvksvgvmgdgrtydyvvalravi
    tsdfmtahwaelpysllgrvsnriinevkginrvvydvsgkppatiewe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tw7D (D:)
    tqdkilildfgsqvtrliarrvreahvycelhsfdmpldeikafnpkgiilsggpnsvye
    sdyqadtgifdlgipvlgicygmqfmahhlggevqpgnqrefgyaqvktidsgltrgiqd
    dapntldvwmshgdkvsklpdgfavigdtpscpiammentekqfygiqfhpevthtkqgr
    allnrfvldicgaqpgwtmpnyieeavakireqvgsdevilglsggvdssvaaalihrai
    gdqltcvfvdhgllrlnegkmvmdmfarnlgvkvihvdaegqfmaklagvtdpekkrkii
    gaefievfdaeekkltnakwlaqgtiypdvilklleplrdlfkdevrelgvalglpremv
    yrhpfpgpglgvrilgevkkeyadllrqaddifiqelrnttdengtswydltsqafavfl
    pvksvgvdgrtydyvvalravitsdfmtahwaelpysllgrvsnriinevkginrvvydv
    sgkppatiewe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5tw7E (E:)
    mahhhhhhmtqdkilildfgsqvtrliarrvreahvycelhsfdmpldeikafnpkgiil
    sggpnsvyesdyqadtgifdlgipvlgicygmqfmahhlggevqpgnqrefgyaqvktid
    sgltrgiqddapntldvwmshgdkvsklpdgfavigdtpscpiammentekqfygiqfhp
    evthtkqgrallnrfvldicgaqpgwtmpnyieeavakireqvgsdevilglsggvdssv
    aaalihraigdqltcvfvdhgllrlnegkmvmdmfarnlgvkvihvdaegqfmaklagvt
    dpekkrkiigaefievfdaeekkltnakwlaqgtiypdviesagaktkkahaikshhnvg
    glpenmklklleplrdlfkdevrelgvalglpremvyrhpfpgpglgvrilgevkkeyad
    llrqaddifiqelrnttdengtswydltsqafavflpvksvgvmgdgrtydyvvalravi
    tsdfmtahwaelpysllgrvsnriinevkginrvvydvsgkppatiewe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tw7E (E:)
    qdkilildfgsqvtrliarrvreahvycelhsfdmpldeikafnpkgiilsggpnsvyes
    dyqadtgifdlgipvlgicygmqfmahhlggevqpgnqrefgyaqvktidsgltrgiqdd
    apntldvwmshgdkvsklpdgfavigdtpscpiammentekqfygiqfhpevthtkqgra
    llnrfvldicgaqpgwtmpnyieeavakireqvgsdevilglsggvdssvaaalihraig
    dqltcvfvdhgllrlnegkmvmdmfarnlgvkvihvdaegqfmaklagvtdpekkrkiig
    aefievfdaeekkltnakwlaqgtiypdvilklleplrdlfkdevrelgvalglpremvy
    rhpfpgpglgvrilgevkkeyadllrqaddifiqelrnttdengtswydltsqafavflp
    vksvgvmrtydyvvalravitsdfmtahwaelpysllgrvsnriinevkginrvvydvsg
    kppatiewe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5tw7F (F:)
    mahhhhhhmtqdkilildfgsqvtrliarrvreahvycelhsfdmpldeikafnpkgiil
    sggpnsvyesdyqadtgifdlgipvlgicygmqfmahhlggevqpgnqrefgyaqvktid
    sgltrgiqddapntldvwmshgdkvsklpdgfavigdtpscpiammentekqfygiqfhp
    evthtkqgrallnrfvldicgaqpgwtmpnyieeavakireqvgsdevilglsggvdssv
    aaalihraigdqltcvfvdhgllrlnegkmvmdmfarnlgvkvihvdaegqfmaklagvt
    dpekkrkiigaefievfdaeekkltnakwlaqgtiypdviesagaktkkahaikshhnvg
    glpenmklklleplrdlfkdevrelgvalglpremvyrhpfpgpglgvrilgevkkeyad
    llrqaddifiqelrnttdengtswydltsqafavflpvksvgvmgdgrtydyvvalravi
    tsdfmtahwaelpysllgrvsnriinevkginrvvydvsgkppatiewe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tw7F (F:)
    mtqdkilildfgsqvtrliarrvreahvycelhsfdmpldeikafnpkgiilsggpnsvy
    esdyqadtgifdlgipvlgicygmqfmahhlggevqpgnqrefgyaqvktidsgltrgiq
    ddapntldvwmshgdkvsklpdgfavigdtpscpiammentekqfygiqfhpevthtkqg
    rallnrfvldicgaqpgwtmpnyieeavakireqvgsdevilglsggvdssvaaalihra
    igdqltcvfvdhgllrlnegkmvmdmfarnlgvkvihvdaegqfmaklagvtdpekkrki
    igaefievfdaeekkltnakwlaqgtiypdviklklleplrdlfkdevrelgvalglpre
    mvyrhpfpgpglgvrilgevkkeyadllrqaddifiqelrnttdengtswydltsqafav
    flpvksvgvtydyvvalravitsdfmtahwaelpysllgrvsnriinevkginrvvydvs
    gkppatiewe