Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.2: GMP synthetase C-terminal dimerisation domain [54810] (2 families) automatically mapped to Pfam PF00958 |
Family d.52.2.0: automated matches [227193] (1 protein) not a true family |
Protein automated matches [226919] (5 species) not a true protein |
Species Neisseria gonorrhoeae [TaxId:485] [326535] (1 PDB entry) |
Domain d5tw7b3: 5tw7 B:395-521 [326582] Other proteins in same PDB: d5tw7a1, d5tw7a2, d5tw7b1, d5tw7b2, d5tw7c1, d5tw7c2, d5tw7c4, d5tw7d1, d5tw7d2, d5tw7e1, d5tw7e2, d5tw7f1, d5tw7f2, d5tw7f4 automated match to d1gpma3 complexed with mg |
PDB Entry: 5tw7 (more details), 2.35 Å
SCOPe Domain Sequences for d5tw7b3:
Sequence, based on SEQRES records: (download)
>d5tw7b3 d.52.2.0 (B:395-521) automated matches {Neisseria gonorrhoeae [TaxId: 485]} gpglgvrilgevkkeyadllrqaddifiqelrnttdengtswydltsqafavflpvksvg vmgdgrtydyvvalravitsdfmtahwaelpysllgrvsnriinevkginrvvydvsgkp patiewe
>d5tw7b3 d.52.2.0 (B:395-521) automated matches {Neisseria gonorrhoeae [TaxId: 485]} gpglgvrilgevkkeyadllrqaddifiqelrnttdengtswydltsqafavflpvksvg vrtydyvvalravitsdfmtahwaelpysllgrvsnriinevkginrvvydvsgkppati ewe
Timeline for d5tw7b3: