Lineage for d5tw7c3 (5tw7 C:395-521)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947226Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 2947245Superfamily d.52.2: GMP synthetase C-terminal dimerisation domain [54810] (2 families) (S)
    automatically mapped to Pfam PF00958
  5. 2947262Family d.52.2.0: automated matches [227193] (1 protein)
    not a true family
  6. 2947263Protein automated matches [226919] (5 species)
    not a true protein
  7. 2947274Species Neisseria gonorrhoeae [TaxId:485] [326535] (1 PDB entry)
  8. 2947277Domain d5tw7c3: 5tw7 C:395-521 [326565]
    Other proteins in same PDB: d5tw7a1, d5tw7a2, d5tw7b1, d5tw7b2, d5tw7c1, d5tw7c2, d5tw7c4, d5tw7d1, d5tw7d2, d5tw7e1, d5tw7e2, d5tw7f1, d5tw7f2, d5tw7f4
    automated match to d1gpma3
    complexed with mg

Details for d5tw7c3

PDB Entry: 5tw7 (more details), 2.35 Å

PDB Description: crystal structure of a gmp synthase (glutamine-hydrolyzing) from neisseria gonorrhoeae
PDB Compounds: (C:) GMP synthase [glutamine-hydrolyzing]

SCOPe Domain Sequences for d5tw7c3:

Sequence, based on SEQRES records: (download)

>d5tw7c3 d.52.2.0 (C:395-521) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
gpglgvrilgevkkeyadllrqaddifiqelrnttdengtswydltsqafavflpvksvg
vmgdgrtydyvvalravitsdfmtahwaelpysllgrvsnriinevkginrvvydvsgkp
patiewe

Sequence, based on observed residues (ATOM records): (download)

>d5tw7c3 d.52.2.0 (C:395-521) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
gpglgvrilgevkkeyadllrqaddifiqelrnttdengtswydltsqafavflpvksvg
vrtydyvvalravitsdfmtahwaelpysllgrvsnriinevkginrvvydvsgkppati
ewe

SCOPe Domain Coordinates for d5tw7c3:

Click to download the PDB-style file with coordinates for d5tw7c3.
(The format of our PDB-style files is described here.)

Timeline for d5tw7c3: