SCOPe 2.06: Domain d5ep8b2: 5ep8 B:71-330

Lineage for d5ep8b2 (5ep8 B:71-330)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families)
   automatically mapped to Pfam PF00591

5. Family c.27.1.0: automated matches [254295] (1 protein)
   not a true family

6. Protein automated matches [254679] (2 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [326393] (1 PDB entry)

8. Domain d5ep8b2: 5ep8 B:71-330 [326398]
   Other proteins in same PDB: d5ep8a1, d5ep8a3, d5ep8b1, d5ep8b3
   automated match to d3h5qa2
   complexed with na, so4

Details for d5ep8b2

PDB Entry: 5ep8, 2.66 Å

PDB Description: x-ray structure of the complex pyrimidine-nucleoside phosphorylase from bacillus subtilis with sulfate ion

PDB Compounds: (B:) Pyrimidine-nucleoside phosphorylase

SCOPe Domain Sequences for d5ep8b2:

Sequence; same for both SEQRES and ATOM records:

>d5ep8b2 c.27.1.0 (B:71-330) automated matches {Bacillus subtilis [TaxId: 224308]}
lsaiegikvdkhstggvgdtttlvlaplvaaldvpvakmsgrglghtggtidkleaidgf
hveltkrefiklvnrdkvavigqsgnltpadkklyalrdvtgtvnsipliassimskkia
agadaivldvktgagafmkteedaaelakamvrignnvgrqtmavisdmsqplgfaigna
levkeaidtlkgegpedlhelvltlgsqmvvlakkadtldearakleevmkngkalekfk
dflknqggdssivddpsklp

Timeline for d5ep8b2:

• d5ep8b2 is new in SCOPe 2.06-stable
  
• d5ep8b2 appears in SCOPe 2.07
  
• d5ep8b2 appears in the current release, SCOPe 2.08