Lineage for d5ep8a1 (5ep8 A:1-70)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000161Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 2000172Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) (S)
    automatically mapped to Pfam PF02885
  5. 2000232Family a.46.2.0: automated matches [254276] (1 protein)
    not a true family
  6. 2000233Protein automated matches [254641] (5 species)
    not a true protein
  7. 2000234Species Bacillus subtilis [TaxId:224308] [326391] (1 PDB entry)
  8. 2000235Domain d5ep8a1: 5ep8 A:1-70 [326392]
    Other proteins in same PDB: d5ep8a2, d5ep8a3, d5ep8b2, d5ep8b3
    automated match to d3h5qa1
    complexed with na, so4

Details for d5ep8a1

PDB Entry: 5ep8 (more details), 2.66 Å

PDB Description: x-ray structure of the complex pyrimidine-nucleoside phosphorylase from bacillus subtilis with sulfate ion
PDB Compounds: (A:) Pyrimidine-nucleoside phosphorylase

SCOPe Domain Sequences for d5ep8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ep8a1 a.46.2.0 (A:1-70) automated matches {Bacillus subtilis [TaxId: 224308]}
mrmvdiiikkqngkeltteeiqffvngytdgsipdyqasalamaiffrdmsdreradltm
amvnsgetid

SCOPe Domain Coordinates for d5ep8a1:

Click to download the PDB-style file with coordinates for d5ep8a1.
(The format of our PDB-style files is described here.)

Timeline for d5ep8a1: