SCOPe 2.06: Domain d5ep8b3: 5ep8 B:331-433

Lineage for d5ep8b3 (5ep8 B:331-433)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (2 families)

5. Family d.41.3.0: automated matches [254277] (1 protein)
   not a true family

6. Protein automated matches [254643] (5 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [326395] (1 PDB entry)

8. Domain d5ep8b3: 5ep8 B:331-433 [326399]
   Other proteins in same PDB: d5ep8a1, d5ep8a2, d5ep8b1, d5ep8b2
   automated match to d3h5qa3
   complexed with na, so4

Details for d5ep8b3

PDB Entry: 5ep8, 2.66 Å

PDB Description: x-ray structure of the complex pyrimidine-nucleoside phosphorylase from bacillus subtilis with sulfate ion

PDB Compounds: (B:) Pyrimidine-nucleoside phosphorylase

SCOPe Domain Sequences for d5ep8b3:

Sequence; same for both SEQRES and ATOM records:

>d5ep8b3 d.41.3.0 (B:331-433) automated matches {Bacillus subtilis [TaxId: 224308]}
qaayqidvpakeagvvseivadeigvaamllgagratkedeidlavgimlrkkvgdkvek
geplvtlyanrenvdeviakvydniriaaeakapklihtlite

Timeline for d5ep8b3:

• d5ep8b3 is new in SCOPe 2.06-stable
  
• d5ep8b3 appears in SCOPe 2.07
  
• d5ep8b3 appears in the current release, SCOPe 2.08