Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries) |
Domain d5ks9c2: 5ks9 C:82-180 [323153] Other proteins in same PDB: d5ks9a1, d5ks9b1, d5ks9b2, d5ks9c1, d5ks9d1, d5ks9d2, d5ks9e1, d5ks9f1, d5ks9g1, d5ks9h1 automated match to d4z7va2 complexed with ca, nag |
PDB Entry: 5ks9 (more details), 2.55 Å
SCOPe Domain Sequences for d5ks9c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ks9c2 b.1.1.2 (C:82-180) automated matches {Human (Homo sapiens) [TaxId: 9606]} atnevpevtvfskspvtlgqpntliclvdnifppvvnitwlsnghsvtegvsetsflsks dhsffkisyltflpsadeiydckvehwgldepllkhwep
Timeline for d5ks9c2: