Lineage for d5ks9c2 (5ks9 C:82-180)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) 
Protein automated matches [190374] (17 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries) 
Domain d5ks9c2: 5ks9 C:82-180 [323153]
Other proteins in same PDB: d5ks9a1, d5ks9b1, d5ks9b2, d5ks9c1, d5ks9d1, d5ks9d2, d5ks9e1, d5ks9f1, d5ks9g1, d5ks9h1
automated match to d4z7va2
complexed with ca, nag
Details for d5ks9c2
PDB Entry: 5ks9 (more details), 2.55 Å
PDB Description: bel502-dq8-glia-alpha1 complex
PDB Compounds: (C:) HLA class II histocompatibility antigen, DQ alpha 1 chainSCOPe Domain Sequences for d5ks9c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ks9c2 b.1.1.2 (C:82-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atnevpevtvfskspvtlgqpntliclvdnifppvvnitwlsnghsvtegvsetsflsks
dhsffkisyltflpsadeiydckvehwgldepllkhwep
SCOPe Domain Coordinates for d5ks9c2:
Click to download the PDB-style file with coordinates for d5ks9c2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5ks9c2:
View in 3D
