Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d5ks9d2: 5ks9 D:93-189 [323123] Other proteins in same PDB: d5ks9a1, d5ks9a2, d5ks9b1, d5ks9c1, d5ks9c2, d5ks9d1, d5ks9e2, d5ks9f2, d5ks9g2, d5ks9h2 automated match to d1sebb1 complexed with ca, nag |
PDB Entry: 5ks9 (more details), 2.55 Å
SCOPe Domain Sequences for d5ks9d2:
Sequence, based on SEQRES records: (download)
>d5ks9d2 b.1.1.0 (D:93-189) automated matches {Human (Homo sapiens) [TaxId: 9606]} rrveptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeettgvvstplirngd wtfqilvmlemtpqrgdvytchvehpslqnpiivewr
>d5ks9d2 b.1.1.0 (D:93-189) automated matches {Human (Homo sapiens) [TaxId: 9606]} rrveptvtispllvcsvtdfypaqikvrwfrndqeettgvvstplirngdwtfqilvmle mdvytchvehpslqnpiivewr
Timeline for d5ks9d2: